- Recombinant Haemophilus influenzae Putative TRAP transporter small permease protein HI_0051 (HI_0051)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1102568
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 18,580 Da
- E Coli or Yeast
- 1-165
- Putative TRAP transporter small permease protein HI_0051 (HI_0051)
Sequence
MGDKEGACFMKIAKYLDKALEYLSILALVIMISLVFFNSVLRYFFDSGIAFSEEFSRICFVYMISFGIILVAKDKAHLTVDIIIPALPEQYRKIVLIVANICVLIAMIFIAYGALQLMSLTYTQQMPATGISSSFLYLAAVISAVSYFFIVMFSMIKDYKESSDK